McDonnell Genome Institute

Washington University

Transcript

lnc-SLIT2-1:5

Chromosome

chr4

Gene Name

lnc-SLIT2-1

Start

19455429

CPC Label

noncoding

End

19580707

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

SDGFISK

Modified Peptide

n[145]SDGFISK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

MRSDGFISKCLAFPPTPLSCRPVKKVLVSLSPSAMIVSFLRPPQACGTVSQ

Conservation Score

0.129

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.132143

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.333795018