McDonnell Genome Institute

Washington University

Transcript

lnc-SLF1-4:2

Chromosome

chr5

Gene Name

lnc-SLF1-4

Start

94592770

CPC Label

coding

End

94594791

Cancer

CCRC

Strand

+

Peptide

YHYQPLLESFVK

Modified Peptide

n[230]YHYQPLLESFVK

Peptide Length

12

ORF Length

275

Open Reading Frame (ORF)

LVTNMLRLRAICPFSWTVFQFRLISCEPLIIQMNKCIDEEQIFDFIERNKIILSEKQVGCTFNILWKLQKQKISLLKNVEYVRDHSQFLTLHNLATNKFKLMNGNTLVNVLYITQQFAGEAHDPLVEALVTEAWGRLERFDIKLLSEFSSCLADQHLYFSPLMGKIADIVHRNLETIQNLSSLSVLMVNISSLISRHFQEQLVNKTELVFDTTDSSEVNVAKRMVQFLRNFRYHYQPLLESFVKFFVALGPIAGPEEKKQLKSTMLLMSEELTNE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.999977

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7491

PhyloCSF Frame 3

0

CNTI Score

0.525845817