McDonnell Genome Institute

Washington University

Transcript

lnc-SLF1-10:2

Chromosome

chr5

Gene Name

lnc-SLF1-10

Start

94111730

CPC Label

noncoding

End

94118006

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

DLVPCIPATPAITK

Modified Peptide

n[145]DLVPCIPATPAITK

Peptide Length

14

ORF Length

99

Open Reading Frame (ORF)

LAAEICITNEEMNVNHQDNGENVSRACHRPLWQPLPPQAQRFRRKKWFRGRGPGSLCCVQSRDLVPCIPATPAITKKDQGAAWAFASEGRSPQALAAST

Conservation Score

0.592

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.355712

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

0.648087486