McDonnell Genome Institute

Washington University

Transcript

lnc-SLCO5A1-8:1

Chromosome

chr8

Gene Name

lnc-SLCO5A1-8

Start

69074356

CPC Label

noncoding

End

69266744

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LHFLVFQPLLIFSSWK

Modified Peptide

n[145]LHFLVFQPLLIFSSWK

Peptide Length

16

ORF Length

33

Open Reading Frame (ORF)

LHFLVFQPLLIFSSWKFSCYLHHLNPSLSFKHT

Conservation Score

0.296

PhyloCSF Frame 1

-5.202

No. of Spectra

6

CPC Coding Probability

0.0525413

PhyloCSF Frame 2 

-5.09

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-5.142

CNTI Score

-0.362288851