McDonnell Genome Institute

Washington University

Transcript

lnc-SLCO5A1-5:1

Chromosome

chr8

Gene Name

lnc-SLCO5A1-5

Start

69859263

CPC Label

coding

End

69860540

Cancer

BRCA-Luminal B

Strand

-

Peptide

NVYLQMK

Modified Peptide

n[145]NVYLQMK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MIQIFRIPKSNIVLSLSCMVMPPVTIPTIKIKVAVFLKNVYLQMKVLLRILKKSYMWWRRSSILNKK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

51

CPC Coding Probability

0.902227

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

0

CNTI Score

-0.313804729