McDonnell Genome Institute

Washington University

Transcript

lnc-SLCO3A1-2:2

Chromosome

chr15

Gene Name

lnc-SLCO3A1-2

Start

92447222

CPC Label

noncoding

End

92449006

Cancer

OV

Strand

+

Peptide

CEMPVTNVYPTTLLTSQLGVRPYTQLPIQPHGR

Modified Peptide

n[145]CEM[147]PVTNVYPTTLLTSQLGVRPYTQLPIQPHGR

Peptide Length

33

ORF Length

54

Open Reading Frame (ORF)

MHVWGHCGREFFLEHTKCEMPVTNVYPTTLLTSQLGVRPYTQLPIQPHGRSPGM

Conservation Score

0.4

PhyloCSF Frame 1

-4.494

No. of Spectra

1

CPC Coding Probability

0.101086

PhyloCSF Frame 2 

-5.34

CNTI Index

noncoding

Max Probability

0.6129

PhyloCSF Frame 3

-4.795

CNTI Score

-0.327803269