McDonnell Genome Institute

Washington University

Transcript

lnc-SLC9C1-2:1

Chromosome

chr3

Gene Name

lnc-SLC9C1-2

Start

112387484

CPC Label

noncoding

End

112409279

Cancer

OV

Strand

-

Peptide

ITLFGAMNVYYVTLGFGGMK

Modified Peptide

n[145]ITLFGAMNVYYVTLGFGGMK

Peptide Length

20

ORF Length

52

Open Reading Frame (ORF)

LIFLKRKNRAFFFSFHNFGKSKITLFGAMNVYYVTLGFGGMKIYCITLGMLI

Conservation Score

0.257

PhyloCSF Frame 1

-4.936

No. of Spectra

5

CPC Coding Probability

0.122214

PhyloCSF Frame 2 

-5.317

CNTI Index

noncoding

Max Probability

0.9841

PhyloCSF Frame 3

-5.215

CNTI Score

-0.350340618