McDonnell Genome Institute

Washington University

Transcript

lnc-SLC9A8-8:2

Chromosome

chr20

Gene Name

lnc-SLC9A8-8

Start

49594608

CPC Label

noncoding

End

49603452

Cancer

OV

Strand

+

Peptide

LPLPALFSPAQQPQGK

Modified Peptide

n[145]LPLPALFSPAQQPQGK

Peptide Length

16

ORF Length

39

Open Reading Frame (ORF)

LPLPALFSPAQQPQGKGSTNFQLFQNKETIAASQESRMQ

Conservation Score

0.029

PhyloCSF Frame 1

0

No. of Spectra

40

CPC Coding Probability

0.03039

PhyloCSF Frame 2 

-4.096

CNTI Index

noncoding

Max Probability

0.9821

PhyloCSF Frame 3

0

CNTI Score

-0.326566006