McDonnell Genome Institute

Washington University

Transcript

lnc-SLC9A3-4:1

Chromosome

chr5

Gene Name

lnc-SLC9A3-4

Start

414823

CPC Label

coding

End

417693

Cancer

OV

Strand

-

Peptide

DQAEAALFK

Modified Peptide

n[145]DQAEAALFK

Peptide Length

9

ORF Length

53

Open Reading Frame (ORF)

LHIWTKPPSLDMGPAQKDQAEAALFKLTKSSSHTVMSAHVLYCECSPVHGTPQ

Conservation Score

0.764

PhyloCSF Frame 1

0

No. of Spectra

32

CPC Coding Probability

0.918714

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

0.728452623