McDonnell Genome Institute

Washington University

Transcript

lnc-SLC7A2-1:1

Chromosome

chr8

Gene Name

lnc-SLC7A2-1

Start

17469517

CPC Label

coding

End

17471618

Cancer

PRAD

Strand

+

Peptide

FAFIMAHELGHTLGTPHDR

Modified Peptide

‚Äč

Peptide Length

19

ORF Length

243

Open Reading Frame (ORF)

LAVVVDRTRFLYQKRNISNVQKDVSLIINEVDAFYSSVEVVVVLLGIEISIEGNPIAINDLYAVLPEFCKWKKVSLNSHIKHDAVHLIVKKGYGRFAGLSYLGTGCSLAGNCGVVSFLDDQMLRFAFIMAHELGHTLGTPHDRIPCTCAEKICIMCPTVNITYRFSNCCYEMLFATTVKTTCLRGSPNPENIFTHKYCGNGVFEEGEECDCGSLFLCTQDLCCLANCTLKPGAACAFGLCCKD

Conservation Score

1

PhyloCSF Frame 1

4.997

No. of Spectra

1

CPC Coding Probability

0.74535

PhyloCSF Frame 2 

-2.349

CNTI Index

noncoding

Max Probability

0.1142

PhyloCSF Frame 3

-2.185

CNTI Score

-0.368651499