McDonnell Genome Institute

Washington University

Transcript

lnc-SLC7A13-1:1

Chromosome

chr8

Gene Name

lnc-SLC7A13-1

Start

86333273

CPC Label

noncoding

End

86343314

Cancer

EOGC

Strand

-

Peptide

LHQSFSTATMLPLILLIK

Modified Peptide

n[145]LHQSFSTATM[147]LPLILLIK

Peptide Length

18

ORF Length

100

Open Reading Frame (ORF)

LLVDFLKSQRTIISACFKSVLRKFAKALAEKFLEKLHQSFSTATMLPLILLIKQGQFYKTFNEKSLGIDLTVLIWLFLTSFCFLILKNLQRAPIFRHLIM

Conservation Score

0.326

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0640595

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0767

PhyloCSF Frame 3

0

CNTI Score

-0.345558319