McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A9-2:15

Chromosome

chr1

Gene Name

lnc-SLC6A9-2

Start

43938657

CPC Label

noncoding

End

43940457

Cancer

OV

Strand

-

Peptide

LEGVVTGDSETR

Modified Peptide

n[145]LEGVVTGDSETR

Peptide Length

12

ORF Length

57

Open Reading Frame (ORF)

LEGVVTGDSETRREGGTKDPESVWRQRGANRVFEGSKGIEIFGASRTGAVNAEEWEH

Conservation Score

0.342

PhyloCSF Frame 1

-4.148

No. of Spectra

1

CPC Coding Probability

0.0162096

PhyloCSF Frame 2 

-3.718

CNTI Index

noncoding

Max Probability

0.9318

PhyloCSF Frame 3

-1.979

CNTI Score

-0.467536958