McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A9-2:13

Chromosome

chr1

Gene Name

lnc-SLC6A9-2

Start

43937905

CPC Label

coding

End

43941401

Cancer

CRC

Strand

-

Peptide

FLEHLELGQ

Modified Peptide

Peptide Length

9

ORF Length

55

Open Reading Frame (ORF)

LQPALCKLYGPGAIFFAGGKVELRIPNPFGGREGPTGCLKGAKASKFLEHLELGQ

Conservation Score

0.342

PhyloCSF Frame 1

-4.148

No. of Spectra

1

CPC Coding Probability

0.976446

PhyloCSF Frame 2 

-3.718

CNTI Index

noncoding

Max Probability

0.9116

PhyloCSF Frame 3

-4.078

CNTI Score

-0.35924153