McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A4-7:1

Chromosome

chr17

Gene Name

lnc-SLC6A4-7

Start

30115261

CPC Label

noncoding

End

30116716

Cancer

CCRC

Strand

-

Peptide

SPPAASK

Modified Peptide

n[230]SPPAASK

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

LFRSPPAASKSVGERNDNVLGQLFAVCGSGTSGISNTGDTVKMTNSRALPQTCRIRNFGVKRVI

Conservation Score

0.174

PhyloCSF Frame 1

-3.052

No. of Spectra

22

CPC Coding Probability

0.00685166

PhyloCSF Frame 2 

-4.01

CNTI Index

noncoding

Max Probability

0.9924

PhyloCSF Frame 3

-2.303

CNTI Score

-0.373116722