McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A3-4:1

Chromosome

chr5

Gene Name

lnc-SLC6A3-4

Start

1383159

CPC Label

noncoding

End

1386409

Cancer

PRAD

Strand

-

Peptide

TQVDPGPR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

80

Open Reading Frame (ORF)

LCYTGLQCPFLWNLALPCGFEEAHGWAGEPQVTRTAGGLWKLTQPLTSKEVKSRVHSSRARDPANIPRSRTQVDPGPREP

Conservation Score

0.231

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0592008

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9938

PhyloCSF Frame 3

0

CNTI Score

-0.267695985