McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A18-6:3

Chromosome

chr5

Gene Name

lnc-SLC6A18-6

Start

1490615

CPC Label

noncoding

End

1492735

Cancer

OV

Strand

+

Peptide

VEISEVVYNGK

Modified Peptide

n[145]VEISEVVYNGK

Peptide Length

11

ORF Length

142

Open Reading Frame (ORF)

LWLSVGSLWSFLCLESFCFFTIPVLFHPCSLVIPNSAKKDDIGREEWRSRLAGWRTRQRNGPDCVVFRCPLFWPKRPMVVPGHTGSGDATLPPSQSCQLVCFVNRVEISEVVYNGKEQNSDVGAFHTQMGPGVNVGGAGGGL

Conservation Score

0.032

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.026913

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9068

PhyloCSF Frame 3

0

CNTI Score

-0.368079548