McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A18-2:1

Chromosome

chr5

Gene Name

lnc-SLC6A18-2

Start

1345193

CPC Label

noncoding

End

1350909

Cancer

BRCA-Basal-like

Strand

+

Peptide

FQLQLSNIR

Modified Peptide

n[145]FQLQLSNIR

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

MKAVDLWSAGGKFQLQLSNIRGLVGSPGWIVSRHPEAGTEAGT

Conservation Score

0.022

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.179597

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

0

CNTI Score

-0.31434672