McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A12-3:4

Chromosome

chr12

Gene Name

lnc-SLC6A12-3

Start

140632

CPC Label

noncoding

End

149115

Cancer

OV

Strand

-

Peptide

AAESDSVGLER

Modified Peptide

n[145]AAESDSVGLER

Peptide Length

11

ORF Length

94

Open Reading Frame (ORF)

LLVGLKLSDALELRGGFISARIAGPRAAESDSVGLERELRVCIANKLPGEADAAGPGTTFWKHCSMPITVGGLRKGRGAVTSSHGASWWLISSP

Conservation Score

0.149

PhyloCSF Frame 1

-3.292

No. of Spectra

1

CPC Coding Probability

0.278976

PhyloCSF Frame 2 

-1.82

CNTI Index

noncoding

Max Probability

0.9856

PhyloCSF Frame 3

-3.907

CNTI Score

-0.316704824