McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A12-2:5

Chromosome

chr12

Gene Name

lnc-SLC6A12-2

Start

157577

CPC Label

noncoding

End

182408

Cancer

HCC

Strand

-

Peptide

IAGVQER

Modified Peptide

n[230]IAGVQER

Peptide Length

7

ORF Length

69

Open Reading Frame (ORF)

LRMKNMTAGMKNLVGDTKDGTEGHFPESQGSKQRWQVENYKSYEDQTRRSTNRIAGVQERESREIGGQK

Conservation Score

0.65

PhyloCSF Frame 1

-4.682

No. of Spectra

20

CPC Coding Probability

0.445891

PhyloCSF Frame 2 

-4.521

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.535

CNTI Score

-0.313690875