McDonnell Genome Institute

Washington University

Transcript

lnc-SLC6A1-1:1

Chromosome

chr3

Gene Name

lnc-SLC6A1-1

Start

11062315

CPC Label

noncoding

End

11072081

Cancer

OV

Strand

+

Peptide

VPDFILELQGFDSWV

Modified Peptide

n[145]VPDFILELQGFDSWV

Peptide Length

15

ORF Length

54

Open Reading Frame (ORF)

LKPLRPRTHQKEETLNTSEHQKEQTLDTPPLGTVTLTERVPDFILELQGFDSWV

Conservation Score

0.704

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00409484

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7357

PhyloCSF Frame 3

0

CNTI Score

-0.398016829