McDonnell Genome Institute

Washington University

Transcript

lnc-SLC5A9-2:5

Chromosome

chr1

Gene Name

lnc-SLC5A9-2

Start

48091392

CPC Label

noncoding

End

48097673

Cancer

OV

Strand

+

Peptide

MEGAGIK

Modified Peptide

n[145]MEGAGIK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

MEGAGIKMNICVQNHITPYTTSSNRRPTYCQRPPATEGSR

Conservation Score

0.363

PhyloCSF Frame 1

-6.32

No. of Spectra

4

CPC Coding Probability

0.076691

PhyloCSF Frame 2 

-3.9

CNTI Index

noncoding

Max Probability

0.9036

PhyloCSF Frame 3

-6.478

CNTI Score

-0.327359542