McDonnell Genome Institute

Washington University

Transcript

lnc-SLC51A-14:1

Chromosome

chr3

Gene Name

lnc-SLC51A-14

Start

195721270

CPC Label

noncoding

End

195734314

Cancer

EOGC

Strand

+

Peptide

LILYNTCFYELK

Modified Peptide

n[145]LILYNTCFYELK

Peptide Length

12

ORF Length

40

Open Reading Frame (ORF)

LILYNTCFYELKVGAMYTLDEDHDWDVFVQVGKILLKPTG

Conservation Score

0.29

PhyloCSF Frame 1

0

No. of Spectra

32

CPC Coding Probability

0.0485932

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.35396456