McDonnell Genome Institute

Washington University

Transcript

lnc-SLC51A-13:1

Chromosome

chr3

Gene Name

lnc-SLC51A-13

Start

195998862

CPC Label

coding

End

196005093

Cancer

PRAD

Strand

+

Peptide

VEHQLLPESPPERPSMR

Modified Peptide

VEHQLLPESPPERPSM[147]R

Peptide Length

17

ORF Length

65

Open Reading Frame (ORF)

LHDPQSRTSAPLRVCSCKNLRVEHQLLPESPPERPSMRTTSAPPRVLHCMTLKLQHQLLAESSAT

Conservation Score

0.023

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.97999

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.318

PhyloCSF Frame 3

0

CNTI Score

-0.265932067