McDonnell Genome Institute

Washington University

Transcript

lnc-SLC50A1-2:1

Chromosome

chr1

Gene Name

lnc-SLC50A1-2

Start

155148543

CPC Label

noncoding

End

155148813

Cancer

EOGC

Strand

+

Peptide

TDQEQKAEGAGDAR

Modified Peptide

n[145]TDQEQKAEGAGDAR

Peptide Length

14

ORF Length

90

Open Reading Frame (ORF)

MPKGKAEGDPKGDKAKVKDEPQRRSARLSAKPSSPKPEPKPKKAPAKKGEKVLKEKKGKADAGKEGNNPAENGDAKTDQEQKAEGAGDAR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.11937

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.718

PhyloCSF Frame 3

0

CNTI Score

0.662442353