McDonnell Genome Institute

Washington University

Transcript

lnc-SLC4A1-2:1

Chromosome

chr17

Gene Name

lnc-SLC4A1-2

Start

44273146

CPC Label

noncoding

End

44274317

Cancer

PRAD

Strand

-

Peptide

LSGDPAELPACISGR

Modified Peptide

LSGDPAELPACISGR

Peptide Length

15

ORF Length

89

Open Reading Frame (ORF)

MDHLSREQRGNDTGVGRLAGEKEFTELGMQTMNLEGQSFGPASLERKGISGQGNSAWKDPEAKRTENIQRKLSGDPAELPACISGRMLR

Conservation Score

0.776

PhyloCSF Frame 1

-4.535

No. of Spectra

5

CPC Coding Probability

0.0543642

PhyloCSF Frame 2 

-4.544

CNTI Index

noncoding

Max Probability

0.9879

PhyloCSF Frame 3

-2.86

CNTI Score

-0.365408177