McDonnell Genome Institute

Washington University

Transcript

lnc-SLC48A1-23:6

Chromosome

chr12

Gene Name

lnc-SLC48A1-23

Start

47719157

CPC Label

noncoding

End

47729203

Cancer

OV

Strand

+

Peptide

DTCPGQPILPSSFSCK

Modified Peptide

n[145]DTCPGQPILPSSFSCK

Peptide Length

16

ORF Length

59

Open Reading Frame (ORF)

LTQRTTKRDTCPGQPILPSSFSCKTKATSFQQRTCVWKDPAAGPSQERPRLTSQGDPGT

Conservation Score

0.349

PhyloCSF Frame 1

-4.66

No. of Spectra

23

CPC Coding Probability

0.0195024

PhyloCSF Frame 2 

-4.326

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-2.822

CNTI Score

-0.334188522