McDonnell Genome Institute

Washington University

Transcript

lnc-SLC47A2-2:9

Chromosome

chr17

Gene Name

lnc-SLC47A2-2

Start

19560110

CPC Label

noncoding

End

19597922

Cancer

OV

Strand

-

Peptide

ETPGNMHMVK

Modified Peptide

n[145]ETPGNM[147]HMVK

Peptide Length

10

ORF Length

70

Open Reading Frame (ORF)

MDGGKSPVNLKAPHRAQRETPGNMHMVKKWNNMNKIVSKVLLQCPSSLPQYQPCLLQISHFKKILALTGR

Conservation Score

1

PhyloCSF Frame 1

-3.522

No. of Spectra

11

CPC Coding Probability

0.0715868

PhyloCSF Frame 2 

-3.082

CNTI Index

noncoding

Max Probability

0.9755

PhyloCSF Frame 3

6.689

CNTI Score

-0.333246569