McDonnell Genome Institute

Washington University

Transcript

lnc-SLC47A2-2:2

Chromosome

chr17

Gene Name

lnc-SLC47A2-2

Start

19640426

CPC Label

noncoding

End

19648625

Cancer

OV

Strand

-

Peptide

AGSRGSSPAEPGQR

Modified Peptide

n[145]AGSRGSSPAEPGQR

Peptide Length

14

ORF Length

108

Open Reading Frame (ORF)

LRAGSRGSSPAEPGQRSFPSCTSIILARPLLRASPQAAFASLPMVPCSRSQERTRCPQVSPSRLIAFRARDFSSHHCTQQQLAQLIGPVLWKAFFSLPFPCTLLHFSF

Conservation Score

0.071

PhyloCSF Frame 1

-3.205

No. of Spectra

9

CPC Coding Probability

0.199054

PhyloCSF Frame 2 

-3.552

CNTI Index

noncoding

Max Probability

0.805

PhyloCSF Frame 3

-2.897

CNTI Score

-0.32409952