McDonnell Genome Institute

Washington University

Transcript

lnc-SLC46A3-7:1

Chromosome

chr13

Gene Name

lnc-SLC46A3-7

Start

28647198

CPC Label

noncoding

End

28659078

Cancer

OSCC

Strand

-

Peptide

ALQVTMPSLTPK

Modified Peptide

n[145]ALQVTM[147]PSLTPK

Peptide Length

12

ORF Length

55

Open Reading Frame (ORF)

LVLKAPARKCHTSLPPHFISQSKKCPYPTLKHPGCLCSPQGRALQVTMPSLTPKK

Conservation Score

0.802

PhyloCSF Frame 1

-5.158

No. of Spectra

8

CPC Coding Probability

0.109625

PhyloCSF Frame 2 

-4.096

CNTI Index

noncoding

Max Probability

0.9899

PhyloCSF Frame 3

-5.22

CNTI Score

-0.349998322