McDonnell Genome Institute

Washington University

Transcript

lnc-SLC46A3-5:1

Chromosome

chr13

Gene Name

lnc-SLC46A3-5

Start

29049885

CPC Label

noncoding

End

29057621

Cancer

LUAD

Strand

-

Peptide

LGTADSAVSIWAK

Modified Peptide

n[272]LGTADSAVSIWAK

Peptide Length

13

ORF Length

39

Open Reading Frame (ORF)

LGTADSAVSIWAKVSREVIFKEVLHVSVVKLLLSGFQKP

Conservation Score

0.494

PhyloCSF Frame 1

-5.551

No. of Spectra

3

CPC Coding Probability

0.046564

PhyloCSF Frame 2 

-3.065

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

-5.27

CNTI Score

-0.357465029