McDonnell Genome Institute

Washington University

Transcript

lnc-SLC45A4-2:7

Chromosome

chr8

Gene Name

lnc-SLC45A4-2

Start

141128821

CPC Label

noncoding

End

141130013

Cancer

CCRC

Strand

-

Peptide

LSGAPHLQK

Modified Peptide

n[230]LSGAPHLQK

Peptide Length

9

ORF Length

125

Open Reading Frame (ORF)

LSGAPHLQKHLPKMGATEERGPRDSPRGGTPRFPAGGPSSQLSKDMSHTKGPGRGEERRGEGSRALLQGTCLSSGAIPGHRRAGSPPGDRDSALGKSAPTHRAPGRPLSDCCPGCRLVAHVRLSF

Conservation Score

0.153

PhyloCSF Frame 1

-2.266

No. of Spectra

4

CPC Coding Probability

0.157271

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-3.574

CNTI Score

-0.327535743