McDonnell Genome Institute

Washington University

Transcript

lnc-SLC45A4-2:5

Chromosome

chr8

Gene Name

lnc-SLC45A4-2

Start

141122676

CPC Label

noncoding

End

141130115

Cancer

EOGC

Strand

-

Peptide

GGDAIWQIR

Modified Peptide

n[145]GGDAIWQIR

Peptide Length

9

ORF Length

42

Open Reading Frame (ORF)

LRRPQRQLGHFLFEEKGGDAIWQIRGPSKVPTESFVPSLKNC

Conservation Score

0.753

PhyloCSF Frame 1

-2.554

No. of Spectra

9

CPC Coding Probability

0.0534681

PhyloCSF Frame 2 

-5.58

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-4.438

CNTI Score

-0.351289545