McDonnell Genome Institute

Washington University

Transcript

lnc-SLC45A1-1:6

Chromosome

chr1

Gene Name

lnc-SLC45A1-1

Start

8423457

CPC Label

noncoding

End

8435011

Cancer

PRAD

Strand

+

Peptide

FILHFMEFPVR

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

109

Open Reading Frame (ORF)

LPSLSSLWPYFCQLQQSSRRSAWRALCPFPLLPSVTMPSRFILHFMEFPVRHAPRFLQGLCQLQGHVMPVTALVSSLASVCLHTPPPNIPVLGILYINVFSYLKTCDNS

Conservation Score

0.173

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0442108

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.466

PhyloCSF Frame 3

0

CNTI Score

-0.33928045