McDonnell Genome Institute

Washington University

Transcript

lnc-SLC44A5-1:1

Chromosome

chr1

Gene Name

lnc-SLC44A5-1

Start

75129973

CPC Label

noncoding

End

75132576

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

AFPGPRPSPPTSRAPAPR

Modified Peptide

n[145]AFPGPRPSPPTSRAPAPR

Peptide Length

18

ORF Length

69

Open Reading Frame (ORF)

LGQTCGDRGEAQLEPERKRGQRRRIQDSRAACRRRNRALLLRTRAFPGPRPSPPTSRAPAPRVQWAIGL

Conservation Score

0.104

PhyloCSF Frame 1

-4.728

No. of Spectra

2

CPC Coding Probability

0.0368674

PhyloCSF Frame 2 

-1.981

CNTI Index

noncoding

Max Probability

0.5942

PhyloCSF Frame 3

-4.049

CNTI Score

-0.330308603