McDonnell Genome Institute

Washington University

Transcript

lnc-SLC43A1-1:1

Chromosome

chr11

Gene Name

lnc-SLC43A1-1

Start

57476492

CPC Label

noncoding

End

57477534

Cancer

HCC

Strand

-

Peptide

FSPGALK

Modified Peptide

n[230]FSPGALK

Peptide Length

7

ORF Length

52

Open Reading Frame (ORF)

LIFTTQGPQWRGKFSPGALKSVQGRLRRKVFLQCQEVEGTRVSRGQGQPGPD

Conservation Score

1

PhyloCSF Frame 1

-3.506

No. of Spectra

30

CPC Coding Probability

0.199151

PhyloCSF Frame 2 

-2.918

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

3.915

CNTI Score

-0.311144585