McDonnell Genome Institute

Washington University

Transcript

lnc-SLC3A2-6:1

Chromosome

chr11

Gene Name

lnc-SLC3A2-6

Start

62840507

CPC Label

noncoding

End

62841835

Cancer

OV

Strand

+

Peptide

ESAPFLEVLQYQVDAWSGR

Modified Peptide

n[145]ESAPFLEVLQYQVDAWSGR

Peptide Length

19

ORF Length

78

Open Reading Frame (ORF)

LFSPRRESAPFLEVLQYQVDAWSGRSKLLFHLLFPKIHLIYCPRIEDVSDIKLIRTDTTLDLSQKAEKRYLYFGRLGG

Conservation Score

1

PhyloCSF Frame 1

-3.443

No. of Spectra

2

CPC Coding Probability

0.167612

PhyloCSF Frame 2 

-2.409

CNTI Index

noncoding

Max Probability

0.5754

PhyloCSF Frame 3

-2.017

CNTI Score

-0.400830539