McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A6-1:5

Chromosome

chr18

Gene Name

lnc-SLC39A6-1

Start

36182661

CPC Label

noncoding

End

36187450

Cancer

BRCA-Basal-like

Strand

-

Peptide

LSAQAALVQDAGIELK

Modified Peptide

n[145]LSAQAALVQDAGIELK

Peptide Length

16

ORF Length

63

Open Reading Frame (ORF)

LSAQAALVQDAGIELKERKRLLPSKISREGSPKEEAFEVGHSSEPVKMGGGVGNVRNTGSLGL

Conservation Score

0.377

PhyloCSF Frame 1

-5.54

No. of Spectra

4

CPC Coding Probability

0.446513

PhyloCSF Frame 2 

-4.535

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-4.756

CNTI Score

-0.290839752