McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A11-1:7

Chromosome

chr17

Gene Name

lnc-SLC39A11-1

Start

72403327

CPC Label

noncoding

End

72592802

Cancer

PRAD

Strand

-

Peptide

LSFIAAVFCDTDAQSAVK

Modified Peptide

LSFIAAVFCDTDAQSAVK

Peptide Length

18

ORF Length

46

Open Reading Frame (ORF)

LSFIAAVFCDTDAQSAVKTFSQVAFGSPCQIMVLHERLTAIRGCGT

Conservation Score

0.758

PhyloCSF Frame 1

-3.426

No. of Spectra

2

CPC Coding Probability

0.0405802

PhyloCSF Frame 2 

-2.818

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.656

CNTI Score

-0.392585374