McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A11-1:47

Chromosome

chr17

Gene Name

lnc-SLC39A11-1

Start

72383198

CPC Label

noncoding

End

72423199

Cancer

OV

Strand

-

Peptide

LSSWDYGCRPPCLANFCIFGR

Modified Peptide

n[145]LSSWDYGCRPPCLANFCIFGR

Peptide Length

21

ORF Length

38

Open Reading Frame (ORF)

LSSWDYGCRPPCLANFCIFGRDRVSPCWPGWSQTPDLK

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.392989

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8367

PhyloCSF Frame 3

0

CNTI Score

-0.293207874