McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A11-1:34

Chromosome

chr17

Gene Name

lnc-SLC39A11-1

Start

72400718

CPC Label

noncoding

End

72592453

Cancer

OV

Strand

-

Peptide

IVGFLFAK

Modified Peptide

n[145]IVGFLFAK

Peptide Length

8

ORF Length

107

Open Reading Frame (ORF)

LFLLLCSQHTHDLKPFLNIYHGSSLSKCRVRAICTSLLFPRRIVGFLFAKIIMGKQLNFKECFIHYQVAMNVNFLMRFCAKCFLPSSPCLFWFKKKKKSTVQGGRET

Conservation Score

0.875

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.23991

PhyloCSF Frame 2 

-3.599

CNTI Index

noncoding

Max Probability

0.9466

PhyloCSF Frame 3

-4.209

CNTI Score

-0.295522365