McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A11-1:32

Chromosome

chr17

Gene Name

lnc-SLC39A11-1

Start

72387595

CPC Label

noncoding

End

72593567

Cancer

EOGC

Strand

-

Peptide

ALASPGIADAR

Modified Peptide

n[145]ALASPGIADAR

Peptide Length

11

ORF Length

78

Open Reading Frame (ORF)

LLVELSMPRALASPGIADARDVVAQGSDSSRWSSWVPSILSPGLLMLGPRCKAKALSLTKMSIMTSIGKEQSTPISKF

Conservation Score

0.165

PhyloCSF Frame 1

-4.907

No. of Spectra

5

CPC Coding Probability

0.380103

PhyloCSF Frame 2 

-4.436

CNTI Index

noncoding

Max Probability

0.7909

PhyloCSF Frame 3

-4.414

CNTI Score

-0.293207874