McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A11-1:3

Chromosome

chr17

Gene Name

lnc-SLC39A11-1

Start

72384301

CPC Label

noncoding

End

72592804

Cancer

BRCA-Luminal B

Strand

-

Peptide

GRFTFSR

Modified Peptide

n[145]GRFTFSR

Peptide Length

7

ORF Length

55

Open Reading Frame (ORF)

LWNSYIPQTRYAPQSLGILSKGRFTFSRSRVGGLTFGTSHKLPGDADGAGPWTPS

Conservation Score

0.157

PhyloCSF Frame 1

-3.261

No. of Spectra

9

CPC Coding Probability

0.158627

PhyloCSF Frame 2 

-1.536

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-4.875

CNTI Score

-0.319591698