McDonnell Genome Institute

Washington University

Transcript

lnc-SLC39A10-11:1

Chromosome

chr2

Gene Name

lnc-SLC39A10-11

Start

194562431

CPC Label

noncoding

End

194576453

Cancer

CRC

Strand

+

Peptide

KCTSVSVSPLYYAFK

Modified Peptide

KCTSVSVSPLYYAFK

Peptide Length

15

ORF Length

34

Open Reading Frame (ORF)

LTSPYTISVSKVLPKPLRKCTSVSVSPLYYAFKS

Conservation Score

0.035

PhyloCSF Frame 1

-5.777

No. of Spectra

1

CPC Coding Probability

0.0890651

PhyloCSF Frame 2 

-5.986

CNTI Index

noncoding

Max Probability

0.6226

PhyloCSF Frame 3

-6.129

CNTI Score

-0.445466906