McDonnell Genome Institute

Washington University

Transcript

lnc-SLC38A8-4:5

Chromosome

chr16

Gene Name

lnc-SLC38A8-4

Start

83735032

CPC Label

noncoding

End

83772868

Cancer

OV

Strand

-

Peptide

GPLGNGQSPR

Modified Peptide

n[145]GPLGNGQSPR

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LLRKSDLTGKGLGRGPLGNGQSPRMVRKDNLFINAGHKLSTR

Conservation Score

0.106

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.146993

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9851

PhyloCSF Frame 3

-5.598

CNTI Score

-0.392557497