McDonnell Genome Institute

Washington University

Transcript

lnc-SLC38A5-1:2

Chromosome

chrX

Gene Name

lnc-SLC38A5-1

Start

48505360

CPC Label

noncoding

End

48508850

Cancer

OV

Strand

-

Peptide

LTMACMELGK

Modified Peptide

n[145]LTM[147]ACMELGK

Peptide Length

10

ORF Length

120

Open Reading Frame (ORF)

LGAYCTTCLAVTWKGEGSPGQTGRHPDLGSQLKQILIRLTMACMELGKSCSLTRLHCPFLLNKRVGLAGFCWETPMVIEEKCIFSLYFNMKLNGVLAHKLVFMYYKQKTFNTVRICIYKE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0493658

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3386

PhyloCSF Frame 3

0

CNTI Score

-0.370709911