McDonnell Genome Institute

Washington University

Transcript

lnc-SLC38A4-2:1

Chromosome

chr12

Gene Name

lnc-SLC38A4-2

Start

46682070

CPC Label

noncoding

End

46682713

Cancer

OV

Strand

-

Peptide

MAHEGEEAQSK

Modified Peptide

n[145]M[147]AHEGEEAQSK

Peptide Length

11

ORF Length

34

Open Reading Frame (ORF)

MAHEGEEAQSKFRQIISAVQYCHQKKIIHRDPKP

Conservation Score

1

PhyloCSF Frame 1

-4.86

No. of Spectra

57

CPC Coding Probability

0.0329784

PhyloCSF Frame 2 

-4.599

CNTI Index

noncoding

Max Probability

0.9775

PhyloCSF Frame 3

-4.331

CNTI Score

-0.343007779