McDonnell Genome Institute

Washington University

Transcript

lnc-SLC38A2-1:15

Chromosome

chr12

Gene Name

lnc-SLC38A2-1

Start

46493190

CPC Label

noncoding

End

46494469

Cancer

CRC

Strand

-

Peptide

LFAYQSMCEFNFMK

Modified Peptide

LFAYQSM[147]CEFNFM[147]K

Peptide Length

14

ORF Length

35

Open Reading Frame (ORF)

LLYPTRDRAEIPSMIYVSTKLFAYQSMCEFNFMKM

Conservation Score

1

PhyloCSF Frame 1

-5.397

No. of Spectra

1

CPC Coding Probability

0.0178105

PhyloCSF Frame 2 

-4.686

CNTI Index

noncoding

Max Probability

0.7426

PhyloCSF Frame 3

-4.657

CNTI Score

-0.451097929