McDonnell Genome Institute

Washington University

Transcript

lnc-SLC38A2-1:13

Chromosome

chr12

Gene Name

lnc-SLC38A2-1

Start

46483417

CPC Label

noncoding

End

46494469

Cancer

OV

Strand

-

Peptide

CIAFHLVAILFR

Modified Peptide

n[145]CIAFHLVAILFR

Peptide Length

12

ORF Length

72

Open Reading Frame (ORF)

LKLTRNFLVGKIWQRCIAFHLVAILFRKQKGGSRLHHPVLGPAFPFGLMSLGSQDFISFHTPISTKKNKNKN

Conservation Score

0.315

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0620763

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8402

PhyloCSF Frame 3

0

CNTI Score

-0.340863444