McDonnell Genome Institute

Washington University

Transcript

lnc-SLC37A2-2:1

Chromosome

chr11

Gene Name

lnc-SLC37A2-2

Start

125088480

CPC Label

coding

End

125090515

Cancer

OV

Strand

+

Peptide

DLQPAVPEPPTR

Modified Peptide

n[145]DLQPAVPEPPTR

Peptide Length

12

ORF Length

247

Open Reading Frame (ORF)

LWGAPFWAGQGQSRLPQLAGRCGARGASGNRGCMQRLRASWSSGWAWAWRACTRSSRPALPAPGSEGLGTRASGCRGCTGSPSSAGPPALCLISRWALAAFPRGRARDLQPAVPEPPTRSMGSCGARASPTSTTPCSRAPSPIDHPRAEECERTARDWQAAPPAAPVRDPLGEASWAPESDGDVESPYVLLRDCKHTNQHPVFSSRFVSAPVDTLYLAALVGPRRTFISSSGIVNTPIGTVYLAQGL

Conservation Score

0.323

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.913058

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9148

PhyloCSF Frame 3

0

CNTI Score

-0.267901966