McDonnell Genome Institute

Washington University

Transcript

lnc-SLC36A1-5:1

Chromosome

chr5

Gene Name

lnc-SLC36A1-5

Start

151806754

CPC Label

noncoding

End

151811350

Cancer

PRAD

Strand

+

Peptide

SLWGGVGWLMPVIPVLWEAEAR

Modified Peptide

SLWGGVGWLM[147]PVIPVLWEAEAR

Peptide Length

22

ORF Length

41

Open Reading Frame (ORF)

LLKLKSLWGGVGWLMPVIPVLWEAEARGLLEARNLRPAWAT

Conservation Score

0.966

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0273827

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9629

PhyloCSF Frame 3

0

CNTI Score

-0.396628524